PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AS_AFF47E71C.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 78aa    MW: 9013.23 Da    PI: 10.4696
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AS_AFF47E71C.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.91.1e-1312631162
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                            +NR++A+  R+RKka++  Le kvk Le++N++L ++ ++l++e + l++ 
  Traes_6AS_AFF47E71C.2 12 LRNRVSAQQARERKKAYLGDLEVKVKDLEKKNSELEERHSTLQNENQMLRQI 63
                           69*********************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-9466IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.7E-171166No hitNo description
SuperFamilySSF579593.13E-131164No hitNo description
CDDcd147046.06E-131158No hitNo description
PfamPF001706.6E-121264IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4381367IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MPPVELDRAG LLRNRVSAQQ ARERKKAYLG DLEVKVKDLE KKNSELEERH STLQNENQML  60
RQILKNTTVS RRGPSEGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_B6e-152766342Transcription factor HY5
2oqq_A6e-152766342Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3576801e-108AK357680.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1059E13.
GenBankAK3655261e-108AK365526.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034M24.
GenBankAK3758151e-108AK375815.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3106C21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571497.15e-41PREDICTED: transcription factor HY5-like
SwissprotO246463e-28HY5_ARATH; Transcription factor HY5
TrEMBLW5GFN24e-50W5GFN2_WHEAT; Uncharacterized protein
STRINGBRADI3G07540.12e-40(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.12e-29bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]